SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 196627.cg1267 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  196627.cg1267
Domain Number 1 Region: 8-337
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 5.86e-37
Family Glycosyl hydrolases family 32 N-terminal domain 0.0044
Further Details:      
 
Domain Number 2 Region: 323-467
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.67e-22
Family Glycosyl hydrolases family 32 C-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 196627.cg1267
Sequence length 498
Comment (Corynebacterium glutamicum ATCC 13032 Bielefeld)
Sequence
MTNVSGYHRPELHITAESGVLFAPAGVLLDDDTWHFFHQYRPSPDHGPRWAHQFAERTPF
VWDICDDVLAPEGDETQVRAGSVVSNNGGVDLYFTSVVGPTSTIQLAHINNIRGTTELIN
EDELGLDPDVSRIGEVVGNTDGYVKFRSPCVIPGWEDQGNRDEGHSGWLMLAVTGPVEAP
TVVVLDSPDGREWSITGPLSLNGLSGLESDEVLVAPRMIRLRDEVDHEIYDVLIVTIEQD
GIDISGYLVGQLNGSEFDVKTPFTRIDFGHDFSRPRNTNYAETTIGYDFAHIFGLMNGVG
RLDSPTEHLSWKEEGWANAISFPRIVTLQDGTVFQTPPEGLLDAIHESEAAAGWTGLCEI
PSNSAVEVALKDQEGEIAATITHRHNQLVVDRSMNPNHAGDPHAIAPLTDDETDSLFIVV
DGSTVEVFADGGYVSMASRVYFNNGPFSEFEVTTTGDASIIRQESHFPVDFSSVSLDIDD
LTALMQFDENEPHEGPVR
Download sequence
Identical sequences A0A2H5I7M6 Q8NRD6
gi|62390006|ref|YP_225408.1| gi|530315279|ref|YP_008401243.1| NP_600344.1.3765 WP_011014131.1.21641 WP_011014131.1.3871 WP_011014131.1.4395 WP_011014131.1.80527 gi|62390006|ref|YP_225408.1| gi|62390006|ref|YP_225408.1| 377293 196627.cg1267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]