SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 196627.cg2478 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  196627.cg2478
Domain Number 1 Region: 7-263
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 9.27e-48
Family beta-Lactamase/D-ala carboxypeptidase 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 196627.cg2478
Sequence length 269
Comment (Corynebacterium glutamicum ATCC 13032 Bielefeld)
Sequence
MQSFKTLESWPVDNVSASVISDGAVHFYGDVDRVFELMSVTKLLATYGFLVAIEEGVFEL
DSPMGPEGSTVRHLLSHASGVAFDKPVAEKGVGERRIYSSAGMDILADAVAAEAEMPFAE
YLREAVFEPLGMENSELWGSAGHEARSTVADLTKFGQELTAPTLISPETLAEAFQVQFPE
LIGTVPGYGMQKPCPWGLGFEIKGQKSPHWTGDLMPENTAGHFGQSGTFFWTVPGSGQVG
VVLTDRNFGPWAKPLWTAFNDEVWAELNS
Download sequence
Identical sequences A0A072ZAV3 A0A0F6Z6F0 A0A1B4WMR4 R0I1L6
196627.cg2478 gi|511057941|ref|YP_008069911.1| gi|62391099|ref|YP_226501.1| gi|530316159|ref|YP_008402123.1| gi|62391099|ref|YP_226501.1| gi|62391099|ref|YP_226501.1| gi|511054703|ref|YP_008066886.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]