SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 196627.cg3291 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  196627.cg3291
Domain Number 1 Region: 79-155
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000696
Family CAP C-terminal domain-like 0.034
Further Details:      
 
Weak hits

Sequence:  196627.cg3291
Domain Number - Region: 22-70
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000477
Family cAMP-binding domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 196627.cg3291
Sequence length 157
Comment (Corynebacterium glutamicum ATCC 13032 Bielefeld)
Sequence
MNPLSKVVACSETSTAPVPSSMISNSWAIETTCALYLPVEALAEVVDAYPQLALAIMRMQ
QDQLVRSRERETAQTTSTVEQRVAAALQHLDAKLGQIRQDGSSLLQVRLRRDDVAGTTVE
SASRAMARMKKTGVIDSGREWIAITNHQALADLVAGL
Download sequence
Identical sequences A0A2H5I4B3 Q8NLH2
gi|62391815|ref|YP_227217.1| NP_602162.2.3765 WP_011015534.1.21641 WP_011015534.1.3871 WP_011015534.1.4395 gi|530316839|ref|YP_008402803.1| 196627.cg3291 gi|62391815|ref|YP_227217.1| gi|62391815|ref|YP_227217.1| 370442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]