SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 197221.tll1566 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  197221.tll1566
Domain Number 1 Region: 2-142
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 2.88e-38
Family N-terminal domain of MutM-like DNA repair proteins 0.00027
Further Details:      
 
Domain Number 2 Region: 137-226
Classification Level Classification E-value
Superfamily S13-like H2TH domain 1.77e-28
Family Middle domain of MutM-like DNA repair proteins 0.00086
Further Details:      
 
Domain Number 3 Region: 225-277
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.34e-17
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 197221.tll1566
Sequence length 284
Comment (Thermosynechococcus elongatus)
Sequence
MPELPEVETVRRGLELVTLKQPIVDVEVLLARSIALPKEPQAFIEHLRDRAIEQWQRRGK
YLLATLDDGSRLVIHLRMSGQLLWLTTPQPPCPHTRVRWFFPTRAELRFVDQRTFGRCWW
LPPDCRVAEAIPALATLAPEPLSEAFTVAFLAARLAHCRRSIKTALLDQSIVAGMGNIYA
DESLFLSGLHPTQSAHTLTPEQVQRLHGVICQVLREGIAAGGTTIRTFMSPAGVNGHYGG
QAWVYGRKGEACRVCGTTIERLRLAGRSSHYCPQCQPLSSAIGK
Download sequence
Identical sequences P59065
gi|22299109|ref|NP_682356.1| NP_682356.1.97157 197221.tll1566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]