SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 197221.tlr0728 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  197221.tlr0728
Domain Number 1 Region: 3-122
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000000000842
Family WD40-repeat 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 197221.tlr0728
Sequence length 123
Comment (Thermosynechococcus elongatus)
Sequence
MSAVGGVAWSATGEYCAAGNMDHTLFVWRSGDQYLWQMQGFPSKVRNLHWLETTNQAPQL
LSQEGIILWHLSEDKSIWQPQVLNLHRRTVGALPIHPHGQGFVSSGDEGWLYYWQQTQPQ
ELL
Download sequence
Identical sequences Q8DKX1
gi|22298270|ref|NP_681517.1| 197221.tlr0728 NP_681517.1.97157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]