SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 197221.tlr0937 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  197221.tlr0937
Domain Number - Region: 65-135
Classification Level Classification E-value
Superfamily OmpH-like 0.0353
Family OmpH-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 197221.tlr0937
Sequence length 149
Comment (Thermosynechococcus elongatus)
Sequence
MASATAQCPSVFNLDKLDRAVRCPPTKEKAMSQQQGGGGAFLGGLLLGSAIGTVVGLLIA
PRSGKETRQLLRKSADALPELLEDITTSFEQHRDRLSEATQERWQATLERLKEAIAVGIE
VTQQQRQTFQREANGRALSDPDEEDAVNQ
Download sequence
Identical sequences Q8DKC2
197221.tlr0937 gi|22298480|ref|NP_681727.1| NP_681727.1.97157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]