SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 197221.tlr1512 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  197221.tlr1512
Domain Number 1 Region: 37-120
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 8.19e-25
Family Canonical RBD 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 197221.tlr1512
Sequence length 193
Comment (Thermosynechococcus elongatus)
Sequence
MPVLALGLGYERFLTPECPFFNHVVFKLPKGGFFMSVRLYVGNLPRDLSREELEALFNQE
VGEVGTTKLITDRKTGKCRGFGFVTVESEEVADQVIEKLNGYTFKDNPLKIEKANDKPKS
EAKEKEEAAAEKSTPNSRSNNRKNNKNNGRRTQVNSAPTEYSSMDTEAAQPDPRWADALA
QLKERLLAQSSNA
Download sequence
Identical sequences Q8DIR9
gi|22299055|ref|NP_682302.1| 197221.tlr1512 NP_682302.1.97157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]