SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 198094.BA_0815 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  198094.BA_0815
Domain Number 1 Region: 47-310
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1.55e-35
Family GpdQ-like 0.0068
Further Details:      
 
Domain Number 2 Region: 452-654
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.05e-30
Family Trypanosoma sialidase, C-terminal domain 0.052
Further Details:      
 
Domain Number 3 Region: 344-443
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000448
Family Fibronectin type III 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 198094.BA_0815
Sequence length 819
Comment (Bacillus anthracis Ames)
Sequence
MDRTALRKVKGLIGLLMVFVLAFVSFPWSTSVKAEEKKQEKVPSEKKIVFPVVSDVHIKN
SGTDDTFRWKRAIEQLNTLAPKQDAFVIVGDFTDTGSLQQYDRFMQVYNENENKDAVRMN
SLGNHDYWNGLSVEGAQKRFLEKTGMESIYYHKVVKGYHFLVMSPENGTTHGYYSDKQIN
WLKEEMAKAQKDDPEKPIFVFLHQHIKETVYGSHEWGTQDSAKINAVLKEYPQAITFSGH
SHYPLDDPRSIHQKDFTSVGTSSISYMEVEGGKVQGNIPPGASTLSQGLLVEVDDEEVTI
NRRDFHTNSWTGEPWKIKLPAKKETFTHVEDRDKEKPSFSTDAKLSVSNVTENAATVTFP
QALDNLLVHSYRVQARDKQTGEIKNKLLAFSEFYRDPVPKDLTFTLAGLDGGKTYTLEVV
AIDSFGNESAQPLTAEVTTKKDNIDPNVKVPKADVFDVNFLDGTFKDNSSFGTKGDVKGN
VSIAYDKALKTNVMKLNGQANTFGYLPFSAAQKEKVANTFTLETVFSMNEIRGQGILQNT
ESGGIGFESTGSGNVELWAHIGGSYKRVGVQLEANKTYHLTGTYNGSEVAIYVDGKKANS
QPAKGKVSHPNVPFAFGADPDSNGNGGIPLNGQIALARLYSKALSSSEVLAAYNEFSNRT
KLEQVNALYEELGKVKEVLAGTYEFGDKPGQYSKEAFQELEKSYNNAKQAFENVGSTGEQ
IVQTYNELKTANVTFVQSKVVEQPKTPKEKLQINIESAKAVVKKAQDANVTDGSVKALSQ
KITVAETVVKDVKVKDAQVETMNRTLEYTISLVEKSINK
Download sequence
Identical sequences Q81UP8
gi|47777855|ref|YP_017452.2| gi|30260956|ref|NP_843333.1| 198094.BA_0815 261594.GBAA0815 568206.BAMEG_3741 592021.BAA_0924 gi|386734651|ref|YP_006207832.1| IDP05329 gi|227816313|ref|YP_002816322.1| gi|229600396|ref|YP_002865397.1| NP_843333.1.87267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]