SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 198214.SF2047 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  198214.SF2047
Domain Number 1 Region: 2-74
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 0.00000000736
Family Lambda integrase-like, catalytic core 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 198214.SF2047
Sequence length 102
Comment (Shigella flexneri 2a)
Sequence
MCENTVNKALRVMGYDTKKDICGHGFRAMACSALMESGLWAKDAVERQMSHQERNTVRMA
YIHKAEHLEARKAMMQWWSDYLEACRESYAPPYTIGKNKFIP
Download sequence
Identical sequences A0A0H2V0B8
198214.SF2047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]