SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 198214.SF3205 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  198214.SF3205
Domain Number 1 Region: 21-167
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.06e-50
Family Ribonuclease PH domain 1-like 0.0000141
Further Details:      
 
Domain Number 2 Region: 324-515
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.89e-46
Family Ribonuclease PH domain 1-like 0.0000178
Further Details:      
 
Domain Number 3 Region: 168-258
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.96e-31
Family Ribonuclease PH domain 2-like 0.001
Further Details:      
 
Domain Number 4 Region: 473-571
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.09e-27
Family Ribonuclease PH domain 2-like 0.0000828
Further Details:      
 
Domain Number 5 Region: 249-348
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 1.2e-25
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0012
Further Details:      
 
Domain Number 6 Region: 631-716
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.97e-23
Family Cold shock DNA-binding domain-like 0.0000219
Further Details:      
 
Domain Number 7 Region: 577-645
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.37e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 198214.SF3205
Sequence length 734
Comment (Shigella flexneri 2a)
Sequence
MRRRSGINTSAVRYCLRKRKDITLLNPIVRKFQYGQHTVTLETGMMARQATAAVMVSMDD
TAVFVTVVGQKKAKPGQDFFPLTVNYQERTYAAGRIPGSFFRREGRPSEGETLIARLIDR
PIRPLFPEGFVNEVQVIATVVSVNPQVNPDIVAMIGASAALSLSGIPFNGPIGAARVGYI
NDQYVLNPTQDELKESKLDLVVAGTEAAVLMVESEAELLSEDQMLGAVVFGHEQQQVVIQ
NINELVKEAGKPRWDWQPEPVNEALNARVAALAEARLSDAYRITDKQERYAQVDVIKSET
IATLLAEDETLDENELGEILHAIEKNVVRSRVLAGEPRIDGREKDMIRGLDVRTGVLPRT
HGSALFTRGETQALVTATLGTARDAQVLDELMGERTDTFLFHYNFPPYSVGETGMVGSPK
RREIGHGRLAKRGVLAVMPDMDKFPYTVRVVSEITESNGSSSMASVCGASLALMDAGVPI
KAAVAGIAMGLVKEGDNYVVLSDILGDEDHLGDMDFKVAGSREGISALQMDIKIEGITKE
IMQVALNQAKGARLHILGVMEQAINAPRGDISEFAPRIHTIKINPDKIKDVIGKGGSVIR
ALTEETGTTIEIEDDGTVKIAATDGEKAKHAIRRIEEITAEIEVGRVYTGKVTRIVDFGA
FVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVDRQGRIRLSIKEATEQSQ
PAAAPEAPAAEQGE
Download sequence
Identical sequences A0A1S9K2C9 C8UGC3 D2A887 E1ILB8
198214.SF3205 198215.S3422 573235.ECO26_4270 585396.ECO111_3988 gi|260869916|ref|YP_003236318.1| NP_708965.2.23235 gi|30064504|ref|NP_838675.1| gi|56480278|ref|NP_708965.2| gi|384544761|ref|YP_005728825.1| gi|260857293|ref|YP_003231184.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]