SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 198466.SpyM3_1570 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  198466.SpyM3_1570
Domain Number 1 Region: 28-341
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 8.14e-84
Family Glycosyl hydrolases family 32 N-terminal domain 0.0000367
Further Details:      
 
Domain Number 2 Region: 340-469
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-27
Family Glycosyl hydrolases family 32 C-terminal domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 198466.SpyM3_1570
Sequence length 479
Comment (Streptococcus pyogenes MGAS315)
Sequence
MDLPQAIRYRPYKEWSSKDYQAITEKMAQSPWHSQFHVEPKTGLLNDPNGFSYFNGRYHL
FYQNWPYGAAHGLKQWVHMTSTDLVHFTETRSRLLPDHAHDSHGAYSGSAYAIDDKLFLF
YTGNVRDANWVRTPLQVGAWMDKQGNISKIPQVLIEQPDDVTEHFRDPQLFSYQGQFYAI
IGAQGLDGKGKIKLYKAVDNHVDNWRFIADLDFDDSGTEYMIECPNLVFVDDKPVLIFSP
QGLAKADLDYQNIYPNTYKIFESFNPETGQLLGGGGLQNLDFGFEAYATQAFSSPDGRVL
AVSWIGLPDIDYPTDRYDYQGALSLVKELRIKDGILYQTPVSALQNLRGPAELFHNKIDS
SNCYELELTIPGQKKLDLLLFADQKGNGLRLKVDTTKGQLSIDRSRAGVQYAQDYGTVRS
CQIPQGHVTLNVYVDNSILEIFINQGQKVLTSRVFPTQGQTGIQVVEGQAFGHYYEMRY
Download sequence
Identical sequences A0A0E1EQQ5 A0A0H2UXD9
198466.SpyM3_1570 gi|21911106|ref|NP_665374.1| WP_011054964.1.11114 WP_011054964.1.12676 WP_011054964.1.13094 WP_011054964.1.13655 WP_011054964.1.16883 WP_011054964.1.17594 WP_011054964.1.17618 WP_011054964.1.22587 WP_011054964.1.23854 WP_011054964.1.26201 WP_011054964.1.27102 WP_011054964.1.30461 WP_011054964.1.31126 WP_011054964.1.34145 WP_011054964.1.34154 WP_011054964.1.3577 WP_011054964.1.35803 WP_011054964.1.41087 WP_011054964.1.42545 WP_011054964.1.47933 WP_011054964.1.49308 WP_011054964.1.51625 WP_011054964.1.5275 WP_011054964.1.52963 WP_011054964.1.53322 WP_011054964.1.53936 WP_011054964.1.55521 WP_011054964.1.59543 WP_011054964.1.60446 WP_011054964.1.62548 WP_011054964.1.62966 WP_011054964.1.6385 WP_011054964.1.64903 WP_011054964.1.66918 WP_011054964.1.67715 WP_011054964.1.67764 WP_011054964.1.71714 WP_011054964.1.72664 WP_011054964.1.7367 WP_011054964.1.74272 WP_011054964.1.74440 WP_011054964.1.74742 WP_011054964.1.74766 WP_011054964.1.75067 WP_011054964.1.77602 WP_011054964.1.81317 WP_011054964.1.81523 WP_011054964.1.84495 WP_011054964.1.86569 WP_011054964.1.87367 WP_011054964.1.89339 WP_011054964.1.89609 WP_011054964.1.92241 WP_011054964.1.92885 WP_011054964.1.95191 WP_011054964.1.95441 WP_011054964.1.97674 WP_011054964.1.99981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]