SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 198804.BUsg361 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  198804.BUsg361
Domain Number 1 Region: 3-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.09e-49
Family Ribonuclease PH domain 1-like 0.0000137
Further Details:      
 
Domain Number 2 Region: 296-468
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.09e-47
Family Ribonuclease PH domain 1-like 0.0000293
Further Details:      
 
Domain Number 3 Region: 453-560
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.09e-27
Family Ribonuclease PH domain 2-like 0.0000959
Further Details:      
 
Domain Number 4 Region: 145-231
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.4e-25
Family Ribonuclease PH domain 2-like 0.0018
Further Details:      
 
Domain Number 5 Region: 231-325
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 3.92e-23
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0032
Further Details:      
 
Domain Number 6 Region: 609-692
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.13e-20
Family Cold shock DNA-binding domain-like 0.0001
Further Details:      
 
Domain Number 7 Region: 555-622
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000104
Family Eukaryotic type KH-domain (KH-domain type I) 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 198804.BUsg361
Sequence length 707
Comment (Buchnera aphidicola Sg)
Sequence
MLNPIVRKFQYGQHTITLETGIMARQATAAVMASMDDTAVFVTVVGEKTTNSSQKFFPLT
VNYQERTYAVGRIPGGFFRREGRPSENEILTARLIDRPIRPLFPKGFCNEIQIIATVVSV
NPQINPDIISIIGASAALSLSGIPFYGPIGAARVGFVNNQYVLNPTIDDMKSSFLDLVVS
GTQNAVLMVEAESKVLSEDKILGAIMFGHQQQQVVINNIRSLSNEASKLPWIISYPEINT
ELELKITKLAEKDISNAYLIFNKQERYEKLNFLKEEIIKLFFSENSNIDISEIEDIFEKI
EKNIVRKRILNNENRIDGREKDMIRALDIRTGVLPRTHGSSLFTRGETQSLVSVTLGTSR
DAQNLDELLGDKTDNFLFHYNFPPYSVGEIGIVGSPKRREIGHGRLAKRSLLAVMPKLDD
FPYTIRIVSEITESNGSSSMASVCGASLALMDAGVPIKSAVAGISMGLVKEGDKYVLLSD
ILGDEDHLGDMDFKVSGTEEGITALQMDIKIEGITNEIMRIALNKAKSARLHILNVMKQA
LSKPRNEISEFAPRIHKIKINPEKIKDVIGKGGSVIRMLTEETGTIIEIEDDGTIKISAT
IGEKAKNAIRRIEEITAEIEVGRIYSGKVTRIVDFGAFISIGIGKEGLVHISQISNKRVE
KVSDHLTVDQIISVKVLEIDRQGRLRLSIKEVENSIISNKSINNIYI
Download sequence
Identical sequences Q8K9H5
198804.BUsg361 WP_011053881.1.33686 gi|21672636|ref|NP_660703.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]