SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 199310.c1468 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  199310.c1468
Domain Number 1 Region: 4-80
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00000184
Family Carboxypeptidase regulatory domain 0.013
Further Details:      
 
Weak hits

Sequence:  199310.c1468
Domain Number - Region: 530-682
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000792
Family Clostridium neurotoxins, the second last domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 199310.c1468
Sequence length 687
Comment (Escherichia coli CFT073)
Sequence
MTVKISGVLKDGTGKPVQNCTIVLKARRTSSTVVVNTVASENPDEAGRYSMDVEYGQYSV
TLLVEDFPPSHAGTITVYEGSRPGTLNDFLGAMTEDDVRPEALRRFELMVNEVARHAGAS
SQSAAAAKKSETAAASSKNAAKTSETNAANSAQAAAASQTASANSATAAKKSETSAKNSE
TATKASEKNAKSSQTAAKTSETNAKDSEANAKVSETAAANSAKASAASQTAAKASEDAAR
EYANQTAEPYRYVLQPLPDVWIPFNDSLDMITGYSPGYKKVKIGDNVVQVASDKQVNFSR
ASTATYINKSGELKTAEINEPRFECDGLLIEGQRTNFFQNSTDPSKWNKSTSLDVTETGT
DSFGFNYGRFVVQDSIVGTSKAHTIIGLYSSTGGVDTSGDEKHVTISCRVKSEVDNIAVR
ILFEHYDGEVRTSIGAANLNLTTRIISKTGQTSRVTARSVKDDATGWIFFEATLKADTTE
NTVGGFVQYSPDTGQMVTSGDYLDVTTPQIEAGTGASSFIVTGTAPATRASDMVTVPIKN
NLYNLPFTVLCEVHKNWYKTPNVAPRVFDTGGHQTGAGIVMGFGSSGGYDGFPYCDIGGS
DRRINENAGLEKMLIGMRVKSERSTCVVSNGKLSSETKTKWEYIRSTATIRIGGQTTAGL
RHLFGHVRNFRLWHKELTDAQLGEVVE
Download sequence
Identical sequences A0A064SSI4 A0A0H2V8P3 A0A237EV49 A0A2G9BN01
199310.c1468 gi|386633745|ref|YP_006153464.1| gi|386628825|ref|YP_006148545.1| gi|26247337|ref|NP_753377.1| WP_000216560.1.101984 WP_000216560.1.10705 WP_000216560.1.16705 WP_000216560.1.16766 WP_000216560.1.19972 WP_000216560.1.20841 WP_000216560.1.21236 WP_000216560.1.22203 WP_000216560.1.22667 WP_000216560.1.25420 WP_000216560.1.27043 WP_000216560.1.27871 WP_000216560.1.28026 WP_000216560.1.30400 WP_000216560.1.35448 WP_000216560.1.35578 WP_000216560.1.36459 WP_000216560.1.37477 WP_000216560.1.40349 WP_000216560.1.40360 WP_000216560.1.40843 WP_000216560.1.41837 WP_000216560.1.41990 WP_000216560.1.44327 WP_000216560.1.45891 WP_000216560.1.47189 WP_000216560.1.48029 WP_000216560.1.49521 WP_000216560.1.51426 WP_000216560.1.53021 WP_000216560.1.54754 WP_000216560.1.56821 WP_000216560.1.57608 WP_000216560.1.58233 WP_000216560.1.59815 WP_000216560.1.63310 WP_000216560.1.66044 WP_000216560.1.66706 WP_000216560.1.68177 WP_000216560.1.69716 WP_000216560.1.69963 WP_000216560.1.72117 WP_000216560.1.74915 WP_000216560.1.76119 WP_000216560.1.7780 WP_000216560.1.78996 WP_000216560.1.80660 WP_000216560.1.8118 WP_000216560.1.81323 WP_000216560.1.82514 WP_000216560.1.83253 WP_000216560.1.85025 WP_000216560.1.85593 WP_000216560.1.86613 WP_000216560.1.88119 WP_000216560.1.89163 WP_000216560.1.89396 WP_000216560.1.90905 WP_000216560.1.91756 WP_000216560.1.9209 WP_000216560.1.94430 WP_000216560.1.95084 WP_000216560.1.95929 WP_000216560.1.96558 WP_000216560.1.96894 WP_000216560.1.97226 WP_000216560.1.97292 WP_000216560.1.98784 WP_000216560.1.99694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]