SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 203119.Cthe_1071 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  203119.Cthe_1071
Domain Number 1 Region: 111-287
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.98e-42
Family RecA protein-like (ATPase-domain) 0.058
Further Details:      
 
Domain Number 2 Region: 26-76
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000794
Family Eukaryotic type KH-domain (KH-domain type I) 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 203119.Cthe_1071
Sequence length 333
Comment (Clostridium thermocellum ATCC 27405)
Sequence
MESLVEVSLEFDRIEHAMNLFGNFDENINIIEDAFNVKIISRDNEIRVVGYSDAVYKAQT
VLQRLIAMAAQGDIISKQNVSYFVQLAEENQLDKIKGFTADFVCLTARGRQIKAKTHGQK
VYVDAIKENDIVFGIGPAGTGKTFLAVAMAVNAFRNKKVNRIVLTRPAVEAGEKLGFLPG
DLQNKVDPYLRPLYDALYEMMGAETYHKYLEKGMIEVAPLAYMRGRTLDDSFIILDEAQN
TTPEQMKMFLTRIGFGSKAVITGDITQIDLPGEKKSGLVEVMKVLKDVKGISFVHLSDMD
VVRHELVQRIIQAYERYDREKKEKGKKESKETN
Download sequence
Identical sequences A3DEC4
gi|125973586|ref|YP_001037496.1| 203119.Cthe_1071 WP_011837961.1.31213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]