SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 203119.Cthe_2219 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  203119.Cthe_2219
Domain Number 1 Region: 45-130
Classification Level Classification E-value
Superfamily FlaG-like 3.92e-27
Family FlaG-like 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 203119.Cthe_2219
Sequence length 131
Comment (Clostridium thermocellum ATCC 27405)
Sequence
MKIESMDAANLQVLKTQYKDYQPNTVNSSNNFGKEASNEKKTHVDVSVSGNESEAGLSQR
AIIKAIEKANKAINGIHTELEFSIHEKSKEIMVKVIDSETKEVIREIPPEKILDMVAAML
EMAGIIVNERG
Download sequence
Identical sequences A3DHJ2
Cth-2341 WP_003513617.1.16390 WP_003513617.1.31213 WP_003513617.1.60145 203119.Cthe_2219 gi|125974704|ref|YP_001038614.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]