SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 203119.Cthe_2354 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  203119.Cthe_2354
Domain Number 1 Region: 110-276
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 7.06e-63
Family NadC C-terminal domain-like 0.00000722
Further Details:      
 
Domain Number 2 Region: 5-109
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 5.89e-31
Family NadC N-terminal domain-like 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 203119.Cthe_2354
Sequence length 277
Comment (Clostridium thermocellum ATCC 27405)
Sequence
MQYISDIDRIIINALREDIPSGDITTDNIIDETSQSEAVLISKDEGVIAGLDVAKKVFLM
LDDQVVFEKMVEDGQTVKRGDIIAKIKGNTRALLKGERTALNLLQRLSGIATKTRQLADK
IKDLPAKLVDTRKTTPGLRVLEKYAVRVGGGYNHRFCLSDGVLIKDNHIKAAGGIKQAVQ
LVREKIPHTMKIEVETETIEQVLEALEAKADIIMLDNMSLDEMKKAVKIIDGRAVTEASG
NVNADTIYDIACTGVDIISVGGLTHSVKAFDISMKFS
Download sequence
Identical sequences A3DHX7
203119.Cthe_2354 gi|125974839|ref|YP_001038749.1| WP_003513372.1.16390 WP_003513372.1.19387 WP_003513372.1.20586 WP_003513372.1.31213 WP_003513372.1.55520 WP_003513372.1.60145 WP_003513372.1.6636 WP_003513372.1.6965 gi|385780281|ref|YP_005689446.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]