SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 203120.LEUM_1408 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  203120.LEUM_1408
Domain Number 1 Region: 37-351
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 6.91e-45
Family Glycosyl hydrolases family 32 N-terminal domain 0.00017
Further Details:      
 
Domain Number 2 Region: 375-486
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000206
Family Glycosyl hydrolases family 32 C-terminal domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 203120.LEUM_1408
Sequence length 503
Comment (Leuconostoc mesenteroides ATCC 8293)
Sequence
MQRHRVRKVLSIIMAGIVLFSIGWLICLKNNSKNMTQQQLPQKWHLNGLSKNGLSNDTQT
ILKNGQKYELFYLVDTGKGLEANQQRTRWARSVSSDLTTFKVADSADIKPVSQQESVATG
SIVKDADNLSGHGKNSLLAYATKYINGNQWTYMWYSTNQGENWHVAHNGKPVAKPYKEGK
DFRDPHVIYDSDAKQFVMTVAEADDNNHMKIGFYISKNGTTWQYTDSFYSPRDLGTLEVP
EIHQIYQKNNNQKQWILFFGANGFADDFQKSTGSYYVVGQLKNGQFEAETDPKRVDFGTD
YYAAHNYQENNEQLLGFGWMGNWDYINRVSDDIKYKGNYSAFRKMFLSSDNKLKTSKIIT
NGLFDTKKKTALVRTHSKSHIKTNKAAYKISTVVNGNQKLTIRAGNGDSNVSFHFNNFDK
KMTVHRQSNYVTNDAYNKDYNINLWGDWSEKVDFYVDQYSIEVFWPKTGQVATFAKYSND
SGDNIVFDNLDNKSSSLVVQEMK
Download sequence
Identical sequences Q03WC1
gi|116618503|ref|YP_818874.1| WP_011680098.1.69199 203120.LEUM_1408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]