SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 203120.LEUM_1648 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  203120.LEUM_1648
Domain Number - Region: 25-51
Classification Level Classification E-value
Superfamily POZ domain 0.0732
Family BTB/POZ domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 203120.LEUM_1648
Sequence length 62
Comment (Leuconostoc mesenteroides ATCC 8293)
Sequence
MIVKIMKSISNFFDNWLAAILFIIGIALIDIGAFYFNVIIGFIVSGLLFIAMAIILNMER
RE
Download sequence
Identical sequences Q03VN2
203120.LEUM_1648 WP_010286651.1.69199 gi|116618742|ref|YP_819113.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]