SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 203122.Sde_0598 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  203122.Sde_0598
Domain Number 1 Region: 55-373
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 6.57e-86
Family alpha-L-arabinanase-like 0.0000021
Further Details:      
 
Domain Number 2 Region: 384-576
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.1e-41
Family Beta-D-xylosidase C-terminal domain-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 203122.Sde_0598
Sequence length 577
Comment (Saccharophagus degradans 2-40)
Sequence
MKIKCLLLAVYAGLLAACALDAPLKTSSKPLAHFSWFEYQGNDEIFKAPLASNQYQNPIL
AGYHPDPSIVRVGEDYYLVNSTFGFYPGIPVFHSRDLVNWTQLGNAIHRPEQLSFDGIHL
GYNGVYAPAIEYRDGTFYVINTCVACGGNFIVTATNPAGPWSDPIWLPEVIGIDPSLFFD
EDGKTYIVHHRNPPVQKYPAHTALWVMEVDSKTFAPVSDDVMLVDGGDEAPWHTEYIEGP
HIYKIDGTYYLYAPGGGTGYFHGQLVYRSDNVFGPYEANPNNPVLTQVGLPDDREHPVTA
TGHADLFQDTNGDWWTVFLGTRVYDLAKPPQDPGNFATGRETFMLPVTWQNGWPHVLEKG
EAVPYRVTKPKLPAGKPAPRAMTGNFTVREEFTNASLAPHWLFVRTPRSKWWQTGNGELI
LEARADTIGAVNQPSFIGRRLAHMTASFATQLTFNPHTVGDEAGLLAVQNDEHFYAFGLG
LNSKGQTVLRVRKKAGKNESIRGDTVAEQVVKLKHGHPIYLRVNIGKAELNFAYSTNGKR
YTTLLNQADANLLTTAKAGGFTGAVVGMYAESTAQQN
Download sequence
Identical sequences Q21N67
203122.Sde_0598 WP_011467083.1.82451 gi|90020247|ref|YP_526074.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]