SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 203122.Sde_0652 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  203122.Sde_0652
Domain Number 1 Region: 326-569
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.99e-67
Family Glycosyl hydrolases family 16 0.0041
Further Details:      
 
Domain Number 2 Region: 180-315
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.04e-32
Family Family 6 carbohydrate binding module, CBM6 0.00011
Further Details:      
 
Domain Number 3 Region: 31-167
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4e-32
Family Family 6 carbohydrate binding module, CBM6 0.0000894
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 203122.Sde_0652
Sequence length 569
Comment (Saccharophagus degradans 2-40)
Sequence
MIKTCKTTPAKWAAALSLGCALLLPSGVNAATFQAEDYSAFYDTTAGNTGGAYRNDNVDI
EATNDNGGGYNVGWIDANEWLVYPGVNITTTGDYVINVRVASASGGALSVDFNAGSIPLG
QFDIPNTGGWQNWVTVSKTVTLTAGTYDMGVFASTGGWNFNWIEVTPVNNGGGNGGGSAT
FFQAEDYSNYSDTTPENIGGAYRNDGVDIETTSDANGGHNIGWMENGEWLAYEGLSIPSN
GNYIIKARVASPNGGALSFDLNGGGQVLGTMNIPATGGWQNWQTVELSTNINAGTYTLGA
FVSTSGFNLNWIEVVAGGDGGNNGGGGGNITWRDEFDTINRDVWNFETGGGGWGNNELQY
YTDGQNASIQFDPQAGSNVLVIEARKETGGQCWWGGNCGYTSSRMNTRFKKSFQYGRIEA
RMKLPRTQGIWPAFWMLGDNFNNVGWPQGGELDIMEHVGTNNITSGALHGPGYSGNTPIT
GHLEHGASIDSGYRVYAVEWDTNGIRWFVDGTNFYSVEKWQVQQYGEWVYDQPFWILLNL
AVGGNWPGDPDHANFTTQRFYIDYVRVIQ
Download sequence
Identical sequences Q21N15
203122.Sde_0652 WP_011467135.1.82451 gi|90020299|ref|YP_526126.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]