SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 203122.Sde_0701 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  203122.Sde_0701
Domain Number 1 Region: 48-272
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.3e-31
Family Xylanase/endoglucanase 11/12 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 203122.Sde_0701
Sequence length 275
Comment (Saccharophagus degradans 2-40)
Sequence
MNIKTFFPALIASVFLLINASTGYAASITKTLCNPADSDNGYGAGTFNGKFYSWFELSQE
DITDCDTKIGFYNETNRHFRVEWNVAQSWGEDAIGGMGWSSGSRDRKIGYNVGQLTTNSS
IQKALVAMYGWSCSTSGGNQISQEYYVVDTWDGGKFVPWDENANNGNGAPAQSVGTVSAN
GATYDVYKVRRNGAQYCFNGSSRSFDQFWSVRRTPRAINGNRNMDFRPHANRWDNSDLGF
KVDGLSSGYQILAVEIFGDANLRHKGAADITLWPR
Download sequence
Identical sequences Q21MW6
203122.Sde_0701 gi|90020348|ref|YP_526175.1| WP_011467184.1.82451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]