SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 203122.Sde_1444 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  203122.Sde_1444
Domain Number 1 Region: 41-278,324-344
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.31e-42
Family Glycosyl hydrolases family 16 0.0072
Further Details:      
 
Domain Number 2 Region: 531-672
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.09e-32
Family CBM4/9 0.0029
Further Details:      
 
Domain Number 3 Region: 912-1043
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.46e-20
Family Galactose-binding domain 0.05
Further Details:      
 
Domain Number 4 Region: 1059-1177
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.8e-20
Family Galactose-binding domain 0.078
Further Details:      
 
Domain Number 5 Region: 373-505
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.04e-16
Family Galactose-binding domain 0.047
Further Details:      
 
Weak hits

Sequence:  203122.Sde_1444
Domain Number - Region: 703-791
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0118
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 203122.Sde_1444
Sequence length 1184
Comment (Saccharophagus degradans 2-40)
Sequence
MIKNNLIKYAVRCAALGALSTSAVHVSATDYNDPYWTNPEVNSDFVDNFNQTQIDRSKWL
VETNIFVNGEDIDYQDVEYPQADWTIGVGQDDPAAIDGKALILKARYMDGEVQDYYGGDP
ANPGKPLFIRSGRIESQITDDTTFTYGKFEARLKMPPARNGEFPAWWLLGNFPDVGWTAC
QELDIMEFTGNNGMNIPQTYWTAPYAVHGGTTVGLAGLGITNPQEQYVTYGIIKTPSKVE
WYINGVLTNTFSRDNQGDDQPWPYVTPMRMILNHAITHVEWPDVGNYNAYSPDANRPSAT
GWSYVDNNGVTQYEYIDVDAMNANIGRAGTDFVVDYVAHWPLPTSDAEHKYVDDSKSSFF
RESGNTKGFYNLKGWLAPVSVTADGFDQPGWDTDVRDNGADNAADGYVGSKWATPNDDGI
HWVEVDYGQDKQINYLWLEWAWNLPADYDIYGKSSTGAWEFITSSQQEVATWATHVFDVN
RTYRYLKLVTKGRIDKSSPIWLLELMAFEDVPNMYPKPAGTTMPNRSVNVLNNGNFSQGL
DSWGTEAFDGANPTYNVQNGAAVIALTNDGGLSGSVQLHTSGFGLKRDYRYHISFDARAD
VARNLMVRLAENNLNPSAAGTYHVETVAVGTSFNTYSFTYDYTGQGEPARLAFLLGGMGT
ATTYIDNVVIREGDFIGSGEPLVAAISSTNFVSASNGWETEWWGAPARAVDGNLGNKASG
NDGEAEGMDLDITVRIDEHYDVRAVLVAGDNSPERSLDQFRVEFGNGTPLMGWTDSTTEG
VYEEFANFNNTPAAGERDFKFFFRPPAGQLVEVADVQLLAVDLMPHRISAIALDEGGTIS
PAGTTRYSRNNTDDATYTFTAPQGQSVSNVIVDGVSMGPLNSYTFTDINADHTLAVSFGG
EVEQPETGDAINYAPEAYATASSELQTAALANDGDAGSRWESEHGAGPSWLALELNDTVR
VSKVVIDWEAANAGTYEIQGSLNGIDWNTLEVVSGGAFGNRTDTVLLDGSASNSVNHIRI
YGVERSAGNNWGYSIFNVEVWGEAGDTSMEEEVEIEPVSAAASSDFQAAANAIDADAGSR
WESAHADATAHLTLDLASTYKLVSVAIDWEAANAGAYTLEGSSDGVNWTTIASFTGGAFG
NRTDTLTVSGSHRFVRINCTEKSAGNNWGYSIYDVRLTALLPTP
Download sequence
Identical sequences Q21KS3
203122.Sde_1444 WP_011467926.1.82451 gi|90021091|ref|YP_526918.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]