SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 203122.Sde_2832 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  203122.Sde_2832
Domain Number 1 Region: 751-876
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.05e-36
Family Family 6 carbohydrate binding module, CBM6 0.00017
Further Details:      
 
Domain Number 2 Region: 624-751
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.63e-33
Family Family 6 carbohydrate binding module, CBM6 0.00045
Further Details:      
 
Domain Number 3 Region: 130-336
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.68e-26
Family Glycosyl hydrolases family 16 0.011
Further Details:      
 
Weak hits

Sequence:  203122.Sde_2832
Domain Number - Region: 69-124
Classification Level Classification E-value
Superfamily Cadherin-like 0.00188
Family Cadherin 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 203122.Sde_2832
Sequence length 877
Comment (Saccharophagus degradans 2-40)
Sequence
MVKNKLYLALSIAAATSLTACGGGGDAADDTVKRNVFAVGDVFKTQEDGDAVEADVSEND
FGRGLTFALESGSTTANGELVFNADGSFTYTPNADFSGKDSFTYVATHTASGDTASALVT
INVISDFETIEESGWTLTWSDEFDSLDSMAWDAMNASASEGVLSVSAVEGQTSYVKSTAA
LGQAGRIEASIQLPDGKSLYSGFGLMPMADMFDGKNALMAIESANNKATAGGHWGIGLVN
GVEINEPTNAVVRAEFHTYAIEWNESLIRWYIDDIHIHTVDTLNTWSYNLSGDTVVADTT
TKPFSQDLQIMMELTAASSGLPNAMLVDFVKVYECDTSVTDQIESCAFAADENVDKLASN
RIESVGEIVTPLFTDELTSLSWHYSDAEEAVTFVTEQESAVPTHRGIVSQPDVMEPVAEV
APVDPVEEGEEGYEEYQAYLAYVDYLNYLETLAFLDTVDPSRERGAVIRYQSDASTWSNF
SLNTPSLGLVGKDSALQFDMYIDSASTTTETIEIRMETGWPFLGTVLLNVADLQLDTWVT
YNIPVSDFLANPFITPDWAVGQDWFLGGNGVEGQPLYLDTNSITKAIVVQLAAPGHLVFD
NVAITCVSNESCFQGPLAKQPIVKAGPAPIIYEAEAYTAVTGEVQTEDTQDAGGGQNVGY
IDAGEALEYTIVAPIDGTYKFQYRLASGLESASEFDVSIDDMLIDGQSLPGTGGWQVWTT
LESGEFDLTAGEHAIVFNFAGGMNFNWFAIVPPPIAIFIEAEDYSSMAGVQLEDTADEGG
GQNVGYIDAGDFLQYNVEVPADGTYFIELRVASSGGSDGFTITSNGITTSTIPVADTGGW
QNWTTQTVEMQLSAGQQTLRFDFIGGAINFNWINVTN
Download sequence
Identical sequences Q21GU0
gi|90022474|ref|YP_528301.1| 203122.Sde_2832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]