SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 203122.Sde_2839 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  203122.Sde_2839
Domain Number 1 Region: 45-360
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.09e-51
Family Alginate lyase 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 203122.Sde_2839
Sequence length 367
Comment (Saccharophagus degradans 2-40)
Sequence
MFKIKNKSLLSLGLVAGAVGVIGCSNTVQEKQMQAGDVVLPAMAYDLSHWKITVPLDDNK
DGKVDEVDTKALQKYMHSDYFYVNSEGGLVFATPNQATTTSGSSNSRSELRQMIRGTNTR
IGTKSPGNNFALASHPQAKAFGDIGGNLKATLAVNHVALNAKYTDKFPAYSVVVGQIHAG
KDKDLIAKGEGYGWGNEPIKIYYKKWPDHKTGSVFWTYERNLEKANPDRTDIAYPVWGNT
WDNSENPGDKGIALDESFSYEINVYKDIMHLTFTAANKPTVKYSINLANNVNAYGKVDEK
DHPKGYLGDWLYFKAGAYDQCSVKDDPGFWYPACAGTGDWETDKKNGDYTRVTFTKLELG
KGYSVSK
Download sequence
Identical sequences Q21GT3
gi|90022481|ref|YP_528308.1| WP_011469312.1.82451 203122.Sde_2839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]