SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 203122.Sde_2927 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  203122.Sde_2927
Domain Number 1 Region: 28-277
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.46e-62
Family Glycosyl hydrolases family 16 0.0046
Further Details:      
 
Domain Number 2 Region: 1320-1439
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.04e-29
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.084
Further Details:      
 
Domain Number 3 Region: 996-1115
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.37e-28
Family Family 6 carbohydrate binding module, CBM6 0.0012
Further Details:      
 
Domain Number 4 Region: 761-967
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.61e-26
Family beta-glycanases 0.06
Further Details:      
 
Domain Number 5 Region: 1172-1303
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.51e-24
Family Galactose-binding domain 0.015
Further Details:      
 
Domain Number 6 Region: 644-727
Classification Level Classification E-value
Superfamily PKD domain 3.27e-18
Family PKD domain 0.0019
Further Details:      
 
Weak hits

Sequence:  203122.Sde_2927
Domain Number - Region: 324-448
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0218
Family CBM11 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 203122.Sde_2927
Sequence length 1441
Comment (Saccharophagus degradans 2-40)
Sequence
MTTRNTFKLSKLLLSLGVLTASSQLVAQDLIWSDEFEGDKIDRSIWSYNVGGSGNGNGEL
QYYTANATNSRIEDGNLVIEARREEMEGKQFTSARLHTNGRFSFKYGTLEARIKLPKLDD
GLWPAFWTLGDNFGVDGWPKSGEIDILEAGYKAAREAGTTNTAVSGAVHWWHESGDWSDW
LQADAHAETHVTTPMNEAYHTYRLEWTPSELSISVNDNTYFTMDITDPNMSEFHGAQHLL
LNLAVGGWNFVEIEDPALITADFPAQMLVDYVRLYSNEFTEVFDANENLPTGDFGVMTDL
TPVFNELNWGDRMHLYIWNNMEVAGIDPYEGTSVLAYDVAPDAWWGMGLLHKDYNMRNYK
HGYLHFMMKTTATSDISINMASTSGGEGAVVLANGGEEYGLERDGEWHEVNIPLAKFGAM
DFETIKTFFSMSGPGQAEAFQIAVDDIYLKSSIALPRPEFGSFGIYTESPENMSAGNFGF
GVEGDLFLWADTLELLPGEVVEGNASLHLKSTGQGWFGMGLTAREGFNLSAFDNADAKLH
LSMKTTDQTDFQVGIKSGSVNDIGQVWIKFTPGNDPYGFARDGQWHDLVIPMSDIAQDLD
MFDVRQVFQLLGFGEIESLAIDNIYISGGGASTPEIVNPSEPVNRAPMAAIKPSVNGGPA
TLSVDFDASQSGDVNGDALTYTWDFGDGTTATGVQVSHDFEKEGNYRVSLIVSDGQATDE
TAAIITVDDNYGLSRSDKRGLGFGHHSVADFEAISQGISWWYNWSIKPDSLIQDVYQNYG
VEFVPMAWNGGFDDQAMRDYINAHRDDVKYILAFNEPNFLEQANMTPSQAAAEWPRLEAI
ADEFGLKIVSVAMNFCGNCVTENGTTYYDPIDYFDDFFEVCPDCRVDALSIHAYMGGVGG
IEWYIDLFAKYNLPIWMTEFSAWDDTTTEEEQIFFMTQAVDYMEQHENVERYAWFTGRRN
GHPYNGLFDYRQSGVLTELGSAYINMPVHGEDSIHTLPKHIEAEAYAYQSGGRVAPTTDA
NGFLQMGENAAGSWVEYNVINPATRSYNVAVRVNSETGGTITVLVDGVEKGQIPVPAAAD
AQAWATVDTDLEITAGEHDVRLVFGASVNLNWLNIGDALSPELEPEPEPEPEPEPEPEPE
PEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEVDPTAPLACTATASSQEGALAPSF
VCDGDAGTRWSSEWNDNETITLDLGDVYEISSINLTWENAYGSKYDILVSDDNVHWTLAY
SEQAGDGGIDNLAVTATGQYVRLLGLERGIGYGFSLFSFDVYGALKPVVVVPEGDLALGK
PTSASSSEWAEPTAANATDGNTGTRWASAWTDSEWISVDMGEVYPVGRVVLNWEGAYGKG
YNIQTSNNGADWTTVYTETAGDGGTDEIILPFASGRYIRVLGTERGTGYGYSLWDFEIYA
D
Download sequence
Identical sequences Q21GJ5
gi|90022569|ref|YP_528396.1| 203122.Sde_2927 WP_011469400.1.82451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]