SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 203122.Sde_3121 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  203122.Sde_3121
Domain Number 1 Region: 56-334
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.73e-73
Family Glycosyl hydrolases family 16 0.0044
Further Details:      
 
Domain Number 2 Region: 574-740
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.11e-17
Family CBM11 0.054
Further Details:      
 
Weak hits

Sequence:  203122.Sde_3121
Domain Number - Region: 402-540
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00179
Family Family 27 carbohydrate binding module, CBM27 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 203122.Sde_3121
Sequence length 742
Comment (Saccharophagus degradans 2-40)
Sequence
MKKLKLLELSLVVLVALGLASCGGSDDKKTPDPVEEPVGEPESEPESEPESEPESEPEPE
NAWQLLWEDNFDSEISASNWGFEVNCTGGGNNEKQCYTDRADNAYVDEAGILHIVAKEEA
FSGPAIQDDDPNYNPDDTSAARNYTSARLRTLDKFDFKYGRVEIRAQIPGGQGSWPALWM
LPSDKVYGGWPASGEIDIMEAVNLDTDAANAVHGTLHYGLQWPQWSTIGASYETNDDFTG
EFHTYAIEWEADQIRWFVDGVHTQTQVSDNWYNFVWGGQESGFAVANPRAPYDQEFHLIM
NVAIGGNWPGDPDTGWASDREMLVDYVRVYQCDSEADDGTGCANATDAVDIAISPTADVG
APSQVEYDLYSDGLQTPAFTNAGVTLAANVWQETEGNVVTTTGNLGDDHGDAWEITFNGT
GNVSIAIAEQDGVESYVRLNGGTAWSNYGVLAFDMYVDSVDAETGFVVKMDSVYPNVGAV
DIATPAAGEWTRVHVKVADILANPIAGGGGLNVAQAVNLFVLEPTGTKTAHVYVDNISIS
CAYNSTAKSWQGDKTCDVAAVPTADTSGIDLSGNELVIFDEQEPDFWGFGQFSAGGAEVA
MSFLADPEDASHGNVLGFSYPDSQNVAYLQSATPLNLSDWAGGTIQFDMYVISEPANVNW
MMKVDCVHPCSSGDIPLTTNIDGVVPAVGVWQTYRFNLDALVAGNPGLDLTKVDTPLVIF
PAWDNQTGANFRIDNIKFVRAN
Download sequence
Identical sequences Q21G01
WP_011469594.1.82451 203122.Sde_3121 gi|90022763|ref|YP_528590.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]