SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 203122.Sde_3468 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  203122.Sde_3468
Domain Number - Region: 3-44
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.00658
Family Di-heme elbow motif 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 203122.Sde_3468
Sequence length 98
Comment (Saccharophagus degradans 2-40)
Sequence
MKNCPHCAKQLSFWDVLRAVNPASIPCGGCHKNITVNKKSAFTTAGVAVLVSIAICLAVQ
SAGLGMPILVASVVLLGLLLEVGYYLCLARGVIKSDLQ
Download sequence
Identical sequences Q21F06
WP_011469938.1.82451 2005474111 203122.Sde_3468 gi|90023108|ref|YP_528935.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]