SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 203122.Sde_3715 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  203122.Sde_3715
Domain Number 1 Region: 61-225
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.89e-23
Family Beta-D-xylosidase C-terminal domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 203122.Sde_3715
Sequence length 235
Comment (Saccharophagus degradans 2-40)
Sequence
MPRFTRKITANKYYTSKFIFLACALLSIFSALCHAEKTTFTLPGITEPVMATHNTSPPSI
NNNSFTLTANKGTDLYTTSSGEKKADNVPRLLFEAKSDFILSAKVTSQFGADYDGGGLLV
YAGENQWAKLLIEQVPNKTLLVSSSVTNTKGDGAYHAVINQPYIYLKIVRLTNRYFFYSS
LNGKDWQILRDFALGENKNAKIGFYNQAPIGEKIETLFSEISFRETTIKSYWQGE
Download sequence
Identical sequences Q21EA9
203122.Sde_3715 gi|90023355|ref|YP_529182.1| WP_011470185.1.82451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]