SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 203124.Tery_2255 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  203124.Tery_2255
Domain Number 1 Region: 263-481
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.09e-37
Family Leech intramolecular trans-sialidase, N-terminal domain 0.051
Further Details:      
 
Domain Number 2 Region: 486-703
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.41e-37
Family Leech intramolecular trans-sialidase, N-terminal domain 0.051
Further Details:      
 
Domain Number 3 Region: 708-925
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.51e-36
Family Leech intramolecular trans-sialidase, N-terminal domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 203124.Tery_2255
Sequence length 1374
Comment (Trichodesmium erythraeum IMS101)
Sequence
MSKVATKNITFWNTTGYNYPGFGKTVEVPDGLGGTISITYNQIDYNDRNWKAKPDGSVPV
TENRFLSGEVGNNFSLTGQVQGITATMPLIRTLGAENNYSVTLDFSKYKASAGGSKATDG
ATSGDTYLAISRFFNGSKTGYTTIKVTARTLDGSELNLGDWKLFNSGTLGQGNNARIFLN
AATQILSGKNSQGKPEFCPTPPNPNSSLGKGTGLGLFELASNQRYVSITLSFKQKKITGS
LPNDLHDIYVASNTSSTSPIDVTPPPMDINRGLQVHLPLNEIVKNAESKKEVVDISGAQV
NGKVNGAKVVADSKFGHCLSFDGVDDYLELPTATIPQTGAITISFWANGDNSLPKDNSII
AAYDQSNNRVINIHLPWNNSYIYFDCGNTGNSYDRIEKLAKAADFKGKWTHWVFTKNVTT
GEMKIYLNGALWSSGKDKSKQISGMTLVKLGSGYGFYHGQVAHLRIYDRVLSAEEINECM
KVDVTPPPMDINRGLQVHLPLNEIVKNAKSKKEVVDISGAQLNGKVNGAKVVADSKFGHC
LSFDGVDDYLELPTATIPQTGAITISFWANGDNSLPKDNSIIAAYDQSNNRVINIHLPWN
NSYIYFDCGNTGNSYDRIEKLAKAADFKGKWTHWVFTKNVTTGEMKIYLNGALWSSGKDK
SKQISGMTLVKLGSGYGFYHGQVAHLRIYDRVLSAEEINECMKVDVTPPPMDINRGLQVH
LPLNEIVKNAKSKKEVVDISGAQLNGKVNGAKVVADSKFGHCLSFDGADDYLELPTATIP
QTGAITISFWANGDNSLPKDNSIIAAYDQSNNRVINIHLPWNNSYIYFDCGNTGNSYDRI
EKLAKAADFKGKWTHWVFTKNVTTGEMKIYLNGALWSSGKDKSKQISGMTLVKLGSGYGF
YHGQVAHLRIYDRVLSTEEINECMKVDGTDATSTTDETDTISTNDVTDVTPTTDGTDTTS
TTDGTDTTPTTGGTDTTPTTSETDTTPTTDGTDTTLTTDRTGTTSTTDITDATSTTDGTG
TTSTTDGTDTTPTTDGTDTTLTTGGNDTTSTNDVTDATSTTDGTGTTSTTGGNDTASTND
VTVTTPTTDGTDTTLTTDGTVTTPTTDGTGTTSTTDGTVTTSTTGGTDTTPTTDGTDTTL
TTDGTDTTLTTDRTGTTSTTDITDATSTTDGTGNTSTTDGTGTTSTTDGTDTTLTTGGND
TTSTTGGNDTTSTTGGNDTASTTGGNDTTPTTDGTDTTSTTGGTDTISTTDGTDTTLTTG
GNDTTSTSDVTDATSTTDSTDTTQKPMEYQIYQVKGNPTIKTGYQGSEWTAVIAGFNCGA
KKKHKATAFTIMPVLDDGEWKIKCDIKDVDDRYWDVAVLFIRNNMVNMLNHFHR
Download sequence
Identical sequences Q112U0
WP_011611852.1.43450 gi|113475896|ref|YP_721957.1| 203124.Tery_2255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]