SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 203124.Tery_2538 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  203124.Tery_2538
Domain Number 1 Region: 109-277
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.75e-37
Family Tandem AAA-ATPase domain 0.05
Further Details:      
 
Domain Number 2 Region: 21-77
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000708
Family Eukaryotic type KH-domain (KH-domain type I) 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 203124.Tery_2538
Sequence length 317
Comment (Trichodesmium erythraeum IMS101)
Sequence
MTEALKIELPNIDSAIALSGYQEENIKFLAKHTGANVVLRGQELLITGTATQIERCQKII
CSLEKLWKHGKTITGVEILTARHAIETNRQDDLEELQQDVLAKTRRGLEIRAKTFRQRKY
VQAIRRHDMTFCVGPAGTGKTFLGAIIAVKALLDNEYERLILTRPAVEAGEKLGFLPGDL
QQKINPYLRPLYDALYELIEPEKVNTLMEKGVIEVAPLAYMRGRTLNNSFVILDEAQNTT
PAQMKMVLTRLGFRSKMIVTGDITQTDLPLTQRSGLLVAMKILRNVEGISICELSQGDVV
RHPLVKRIVAAYEDYEK
Download sequence
Identical sequences Q111T4
WP_011612103.1.43450 gi|113476152|ref|YP_722213.1| 203124.Tery_2538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]