SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 203124.Tery_3601 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  203124.Tery_3601
Domain Number - Region: 1-50
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.036
Family DBL homology domain (DH-domain) 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 203124.Tery_3601
Sequence length 62
Comment (Trichodesmium erythraeum IMS101)
Sequence
MLLSSLLEQVKKNSSDKEIIKEILTECELIIDSYEHGIERPEKSEEQKEYYSGKKKSHTR
KS
Download sequence
Identical sequences Q10YJ7
gi|113477089|ref|YP_723150.1| 203124.Tery_3601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]