SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 203124.Tery_4004 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  203124.Tery_4004
Domain Number 1 Region: 2-39
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000165
Family Canonical RBD 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 203124.Tery_4004
Sequence length 40
Comment (Trichodesmium erythraeum IMS101)
Sequence
MYIGNLSKGVMERQELQDVFQEEGDSVTTKLITDRKTGKW
Download sequence
Identical sequences Q10XJ7
gi|113477439|ref|YP_723500.1| 203124.Tery_4004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]