SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 203907.Bfl108 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  203907.Bfl108
Domain Number 1 Region: 3-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.08e-48
Family Ribonuclease PH domain 1-like 0.0000219
Further Details:      
 
Domain Number 2 Region: 305-470
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.58e-48
Family Ribonuclease PH domain 1-like 0.000036
Further Details:      
 
Domain Number 3 Region: 145-235
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.27e-27
Family Ribonuclease PH domain 2-like 0.0016
Further Details:      
 
Domain Number 4 Region: 452-551
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 4.51e-24
Family Ribonuclease PH domain 2-like 0.00018
Further Details:      
 
Domain Number 5 Region: 610-692
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9.08e-21
Family Cold shock DNA-binding domain-like 0.00012
Further Details:      
 
Domain Number 6 Region: 226-327
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 2.75e-16
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0045
Further Details:      
 
Domain Number 7 Region: 554-631
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000501
Family Eukaryotic type KH-domain (KH-domain type I) 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 203907.Bfl108
Sequence length 697
Comment (Candidatus Blochmannia floridanus)
Sequence
MLNSIVHKFQYGQHTVVLNTGAIARQANAAVMVSIGDTTVLVTVVSSNQEKIDQGFFPLV
VHYQERTYAAGKFPGGFFRREGRPSESEILTSRLIDRPIRPLFPKGFLNDIQIIATVVSV
NPQIHPDIVAMIGVSAALSLSDIPFFGPIGAARVGYIKDQYILNPTTIELSNSKLDLVVA
GTDSNILMVESAACVLSEQEMLNAIVFGHEQQQTVIQNINQLVKKAGKVKYDWKLKDMDI
LLSEYLSNLYRSRVNVSCLVGVNKKDRQEQLNNIKHDIIDITLREYNENIDVNEVMSFLN
NLEIKLLRSSILRDNVRFDGRSPDMIREIDISAGILPRTHGSALFTRGDTQALVTATLGT
ERDAQNLDELTGDRVDRFLLHYNFPPYCTGEIGIVGAPRRREIGHGRLAKRGMLAVMPNS
NEFPYTVRVVSEVTESNGSSSMASICGASLALMDAGVPIKESVAGVAMGLIKENSNFIIL
SDIISDEDHIGDMDFKVSGTRTGITALQMDIKIKGITYDIIEVSFKKARCALLRILDIMD
QVIKIPRKDISEFAPRIYSIKINPDKIKDVIGKGGSVIRALTEKTSTIIDIEDDGVIKVI
SLNAEKAKQAVDRIQEITANIAIGSIYTGRVTHIVDFGAFVTLFAGKEGLVHISQITEKR
VNRVSDYLKLGQEVLVKVLEIDRQGRMRLSMRGINHI
Download sequence
Identical sequences Q7VQM0
gi|33519583|ref|NP_878415.1| WP_011126398.1.13780 203907.Bfl108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]