SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 203907.Bfl310 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  203907.Bfl310
Domain Number 1 Region: 4-100
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 3.43e-32
Family Iojap/YbeB-like 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 203907.Bfl310
Sequence length 101
Comment (Candidatus Blochmannia floridanus)
Sequence
MLKNFILNYLDDLKGQNIICFDIHNKNRITDFMILCTGRSNHHVKSIAQSILKKIKSMKQ
KWNRVEGIEFGEWVSIDLGEIIIHIMKYETRKLYDLEKLWT
Download sequence
Identical sequences Q7VRA9
WP_011126588.1.13780 gi|33519773|ref|NP_878605.1| 203907.Bfl310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]