SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 204536.SULAZ_0563 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  204536.SULAZ_0563
Domain Number 1 Region: 295-488
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.43e-50
Family Ribonuclease PH domain 1-like 0.0000324
Further Details:      
 
Domain Number 2 Region: 5-145
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.16e-45
Family Ribonuclease PH domain 1-like 0.0000571
Further Details:      
 
Domain Number 3 Region: 450-549
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.26e-28
Family Ribonuclease PH domain 2-like 0.0001
Further Details:      
 
Domain Number 4 Region: 139-232
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.01e-27
Family Ribonuclease PH domain 2-like 0.0013
Further Details:      
 
Domain Number 5 Region: 556-640
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.64e-21
Family Eukaryotic type KH-domain (KH-domain type I) 0.0042
Further Details:      
 
Domain Number 6 Region: 618-693
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.22e-17
Family Cold shock DNA-binding domain-like 0.00082
Further Details:      
 
Domain Number 7 Region: 243-319
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00000000000000654
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 204536.SULAZ_0563
Sequence length 707
Comment (Sulfurihydrogenibium azorense Az Fu1)
Sequence
MEIEEIKVQTEVNGAPFIIETGYFAKQANGAVIVRQGDTAVLVAAVMSEEPQADIDFLPL
TVEYREKYYAYGKIPGGFVKREGKPTDREILVARNIDRPIRPLFPKGFYNDIVITAYTLS
ADDKYDPDVLGIVGASAALHISDIPFEGPIAGVRVCRVNGEFIVNPTYQQKAQADIEIVV
AGSKDAIVMVEGGAKEVPEEDILEAMMFGHQEIKKLIELQEELRLKCGKEKIQVAIDEEE
IILKDKLKEFSYEKIKEAFKITDKKQRNKTINAIFEEAFKTLEIPEEKIKKASFIYKDIV
SNVMRDNILNEGIRIDGRKPEEIRPIWIKVGVFPRNHGSAIFTRGQTQAFVTVTLGSLSE
GQIEESIEAGEVMKRFMLHYNFPPFSTGEAKPPRATSRREIGHGNLAERALEPLIPPEEE
FPYAIRVVSDILESNGSTSMATVCGGSLALFDAGVPMKKHVAGIAMGLIKAEDKFVILSD
ILGDEDHLGDMDFKVAGTRDGVTSIQMDIKVKGLTKEILEKALQQARDGRNYILDLMYQA
IPEPRKEVSPYAPTVTTLRVLPDKIPIIIGPAGKNIKKIIEETKVKIDLDPEGLVKIYAT
SKEAAEKAVSMINELILDVEVGEVYMGKVTRVEDYGAFVELLPGRLSLLHVSQITGERLK
SAKEKIKVGDVLKVKVSEIDDQGRIKVSLKDVPENVEPKNKFLFKEE
Download sequence
Identical sequences C1DTW6
204536.SULAZ_0563 gi|225848390|ref|YP_002728553.1| WP_012674909.1.69036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]