SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 204536.SULAZ_1165 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  204536.SULAZ_1165
Domain Number 1 Region: 2-166
Classification Level Classification E-value
Superfamily PIN domain-like 8.83e-58
Family 5' to 3' exonuclease catalytic domain 0.0000178
Further Details:      
 
Domain Number 2 Region: 167-282
Classification Level Classification E-value
Superfamily 5' to 3' exonuclease, C-terminal subdomain 2.39e-30
Family 5' to 3' exonuclease, C-terminal subdomain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 204536.SULAZ_1165
Sequence length 298
Comment (Sulfurihydrogenibium azorense Az Fu1)
Sequence
MDKKLLLVDGSSYLYRAYYALPPLSAPDGTPTGAIYGFVRMLLKLISTFNTPYIAVVFDR
PEKTVRHKIYKEYKATRKETPNDLQVQIPKIKEIIKLLGIKILEIPGYEADDIIATLSKK
AENRSFEVIIVTPDKDMNQLIDQHIKIFNPMKEEIVDTQKVIEKYGVSPQQFIDYLVLVG
DSIDNIPGIKGVGPKTAASLLQEFGSIDRILENKDKLKGKLKESFAAVSKEDIQLVRSLV
KLHQDIDIPVEIESLKKDKPDLIKLKEIFEKLGFKSLIKEIEKPNLEKKQTIVQKSLF
Download sequence
Identical sequences C1DVJ9
WP_012674129.1.69036 204536.SULAZ_1165 gi|225848972|ref|YP_002729136.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]