SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 204536.SULAZ_1433 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  204536.SULAZ_1433
Domain Number 1 Region: 5-203
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.76e-17
Family Extended AAA-ATPase domain 0.012
Further Details:      
 
Domain Number 2 Region: 220-318
Classification Level Classification E-value
Superfamily post-AAA+ oligomerization domain-like 0.00000459
Family DNA polymerase III clamp loader subunits, C-terminal domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 204536.SULAZ_1433
Sequence length 330
Comment (Sulfurihydrogenibium azorense Az Fu1)
Sequence
MNEIKIQQLLKEYNLSNLKPLILIYGNEELTKSLFLEKVKSTTASTVFWGDSLDFKTLLN
ELGTKSLFQTEKTIIVKNFDEFVSNLKKDEIKLFLETLKKVNLPTRFIMVCSFEKIPSTE
PYKTITTLADILVSTKLTPSAFYTSIKNKLSRESKKISEEDLKYLVSLLNNDLTLAKNEI
EKLLLYTADKDTITKEDIDAVITPKFEDNVFVFLTQFFKKDKTALKTLLNLIENGSHPFE
IQSLILYQLEKTLYFKSLIEKGIDQEEAFKTVGITAPIQKSNILNILKVLKEEDLEKLIK
GLYTLEIQQKVFFQDPIEKLTEFVVKNLVK
Download sequence
Identical sequences C1DWB3
gi|225849236|ref|YP_002729400.1| 204536.SULAZ_1433 WP_012673628.1.69036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]