SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 204669.Acid345_0301 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  204669.Acid345_0301
Domain Number 1 Region: 20-176
Classification Level Classification E-value
Superfamily LigT-like 2.27e-18
Family 2'-5' RNA ligase LigT 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 204669.Acid345_0301
Sequence length 184
Comment (Candidatus Koribacter versatilis Ellin345)
Sequence
MCCMQSLQYALVAYVRSPIGIFVEQLRREIHPEHAHLAAHVTVLPPRPLRGTEADALAEV
QRMAEAHPAFEIGMGEVETFAPSTPTIFIRVARAAYRMRELHDALNTGVLQYDEPWPYMP
HMTIAKLNCLPDAESLVDTARARWRDYKGSKEVVIDNLAFVRGSGHTWFDIAEFSLQAAA
KMPR
Download sequence
Identical sequences Q1IUZ4
gi|94967332|ref|YP_589380.1| WP_011521108.1.86553 204669.Acid345_0301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]