SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 204669.Acid345_1630 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  204669.Acid345_1630
Domain Number 1 Region: 59-249
Classification Level Classification E-value
Superfamily Pseudouridine synthase 1.46e-40
Family Pseudouridine synthase RsuA/RluD 0.00036
Further Details:      
 
Domain Number 2 Region: 12-79
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 0.0000000196
Family Ribosomal protein S4 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 204669.Acid345_1630
Sequence length 254
Comment (Candidatus Koribacter versatilis Ellin345)
Sequence
MTNTGKPVKSRRIGLARVLSKLGYCSRARAFELIRADEVRVNGKVERNPERPTDPARDRV
EVAHIAIRAARFLYYVVNKPRGLITTASDEKGRETIYSLLPPDSPWVAPVGRLDKASEGL
LLLTNDSEWAAKITDPNSHLDKTYHVQVSTLPSEQMVEALSRGIRSDGELLLAKRVSILR
AGGKNGWLEIVLEEGKNRQIRRMVAALQIEVLRLIRVAIGPLTLGELPKGGCRALTAEEK
AELDDALRLVRGEH
Download sequence
Identical sequences Q1IR68
WP_011522434.1.86553 gi|94968658|ref|YP_590706.1| 204669.Acid345_1630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]