SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 204669.Acid345_2387 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  204669.Acid345_2387
Domain Number 1 Region: 130-384
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.34e-62
Family Glycosyl hydrolases family 16 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 204669.Acid345_2387
Sequence length 384
Comment (Candidatus Koribacter versatilis Ellin345)
Sequence
MTNQLKRSSLVFLLSGKRSAAAAFSLLCVIITAGCGGGSSGGGTTPPPPAQVATPTVTMT
AAQNGGQVVTMADTTSGASIFFTTDGSTPTSTSQQYLTPVLIASNVTIKVVATVSGMTDS
DVTSQSVSGIASGALVWSDEFSNSSGSNVQPDASVWTYDTGAGGWGNAELETYCAYGSTT
SPCDTALPNTYVGTDGYLHVVARNASGGAYTSARLKTQGLFSTSYGRVEALIKMPEGQGL
WPAFWMLGNNITTVNWPACGEHDIMEHINAPLPDWFAGSIHGAGNLNGSVTWPTAAQTYT
ASDWHIYGMIWSKGKVQYYIDDPSNVYASFDSTTITTGTWPFDSDGGAFIILNMAVGGSW
PGAPDATTPFPSEMLVDYVRVYAN
Download sequence
Identical sequences Q1IP12
WP_011523189.1.86553 204669.Acid345_2387 gi|94969414|ref|YP_591462.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]