SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 204669.Acid345_3627 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  204669.Acid345_3627
Domain Number 1 Region: 19-294
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-61
Family Glycosyl hydrolases family 16 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 204669.Acid345_3627
Sequence length 394
Comment (Candidatus Koribacter versatilis Ellin345)
Sequence
MRDMRSLLRVLAILLFCLPSAFAQDWGSPVWQDEFNQAAGSPLDPQKWVFDLGDLKVNHE
VEIYCPGFPSQKDQLTARRAEALKEIEVCDPKDGNVSFDGEHLILRAVKHSGVWTSGRIK
TQGKQTFQYGRIEARMKLPFGAGIWPAFWGLGENITKVGWPASGEIDIMEDVPEIGGLGP
TRIRSTVHGPGYSGEYGVRNDIEFPKGERVDNGFHTYGVIWSPNMMQFYLDDPKNVFFVM
TPRELVPGKEWVYNAPFFLIANLAIGSEKSWSGATNESTPNPADMLIDYVRVYKAAKVEG
PKIERAAAGSGLDLPIKLSAKAGSGRMYLECLSVAPGVSCATEPHVVDFSSGSSASAILR
VTAQKTPVKEADIVLKIYTVSGEETSQTFHLKLQ
Download sequence
Identical sequences Q1IKH2
204669.Acid345_3627 gi|94970654|ref|YP_592702.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]