SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 204669.Acid345_3886 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  204669.Acid345_3886
Domain Number 1 Region: 40-365
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 2.13e-92
Family Glycosyl hydrolases family 32 N-terminal domain 0.0000000428
Further Details:      
 
Domain Number 2 Region: 354-506
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.72e-25
Family Glycosyl hydrolases family 32 C-terminal domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 204669.Acid345_3886
Sequence length 507
Comment (Candidatus Koribacter versatilis Ellin345)
Sequence
MLASVWRSGFRNAILIDSSPMRHVLALLALIAVALPALPQYDQPYRPQVHFSPREHWTND
PNGLVFFDGEYHLFFQYNPFGDVWGHMSWGHAVSKDLLHWEELPVAVPEKDGVMIFTGSV
VVDHENSSGFCKPKTECLVAIYTGYQEHFPGGTRQAQYVAYSVDRGRTWTNYDKNPVIDL
KMADFRDPSVFWDEERHRWVMAVSLPKEHDVQFYSSTNLKQWALLSEFGQLGDTDGDWEC
PDLLRVPSAQDPTKSTWALKVGLNPGAPQGGSGEQYFFGAFDGKTFTASHEKGAHGWTNY
GKDDYCAINFNNIAKDEKPVLLGWMSNWEYAAKLPTSPWRGQMSLPRRLSFVKDVEGLGL
KQEPVVETLRDGAATTLTSAPREAPFELQVTFDPKAEQIFGMRIYSDKEHYVEIGFDRKN
QQLFMDRTKSSVTVAQEFPGTTVAPLTEGRGFDLHVIVDRSSVEAFAQDGTIAMNNLVFP
TKPQVRVETFGSKPTSAQVWKLKSIWK
Download sequence
Identical sequences Q1IJR4
gi|94970912|ref|YP_592960.1| 204669.Acid345_3886 WP_011524685.1.86553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]