SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 204773.HEAR1539 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  204773.HEAR1539
Domain Number 1 Region: 98-302
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 7.06e-37
Family Lambda integrase-like, catalytic core 0.0062
Further Details:      
 
Domain Number 2 Region: 7-97
Classification Level Classification E-value
Superfamily lambda integrase-like, N-terminal domain 2.94e-24
Family lambda integrase-like, N-terminal domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 204773.HEAR1539
Sequence length 332
Comment (Herminiimonas arsenicoxydans)
Sequence
MDKIDQYIHAATRQNTRRSYQSAIHHYEVEWRGYLPATAESVARYLADYAETLAINTLRH
RLAALGQWHIDQGFPDPTKAPIVRKVFRGIQQLHPVQEKRAKPLQLEQLEQVTTWLDGAI
VAAGAEHDSAAQLRHTRDKALVLIGFWRGFRGDELARLEVQYVAALPGEGMTCYLPQTKG
DRQFKGSTFKAPALSRLCPVAAYQAWVDLSGLESGAVFRSINRWGKLGDTGLNPASIIPL
LRSLFAQAGILDADEYSAHSLRRGFANWATSNGWDLKTLMEYVGWKNIQSAMRYIDGADP
FGKKRIEAGLLPVELQTKSNDLLRNITDQEIL
Download sequence
Identical sequences A4G5B7
gi|134094756|ref|YP_001099831.1| WP_011871034.1.36655 204773.HEAR1539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]