SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 205913.BLD_0123 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  205913.BLD_0123
Domain Number 1 Region: 36-356
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 9.26e-92
Family Glycosyl hydrolases family 32 N-terminal domain 0.00000635
Further Details:      
 
Domain Number 2 Region: 355-515
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.14e-27
Family Glycosyl hydrolases family 32 C-terminal domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 205913.BLD_0123
Sequence length 518
Comment (Bifidobacterium longum DJO10A)
Sequence
MTDFTPETPVLTPIRDHAAELAKAEAGVAEMAAKRNNRWYPKYHIASNGGWINDPNGLCF
YKGRWHVFYQLHPYGTQWGPMHWGHVSSTDMLNWKREPIMFAPSLEQEKDGVFSGSAVID
DNGDLRFYYTGHRWANGHDNTGGDWQVQMTALPDNDELTSATKQGMIIDCPTDKVDHHYR
DPKVWKTGDTWYMTFGVSSADKRGQMWLFSSKDMVRWEYERVLFQHPDPDVFMLECPDFF
PIKDKDGNEKWVIGFSAMGSKPSGFMNRNVSNAGYMIGTWEPGGEFKPETEFRLWDCGHN
YYAPQSFNVDGRQIVYGWMSPFVQPIPMEDDGWCGQLTLPREITLGDDGDVVTAPVAEME
GLREDTLDHGSVTLDMDGEQIIADDAEAVEIEMTIDLAASTAERAGLKIHATEDGAYTYV
AYDGQIGRVVVDRQAMANGDRGYRAAPLTDAELASGKLDLRVFVDRGSVEVYVNGGHQVL
SSYSYASEGPRAIKLVAESGSLKVDSLKLHHMKSIGLE
Download sequence
Identical sequences A0A083WZN5 A0A0A6Y4P8 A2TLS9 B3DQ70 C2GW80 F8AUE6 R5NC84
WP_007054055.1.11999 WP_007054055.1.12982 WP_007054055.1.13888 WP_007054055.1.23590 WP_007054055.1.26381 WP_007054055.1.30534 WP_007054055.1.41489 WP_007054055.1.49397 WP_007054055.1.50584 WP_007054055.1.51274 WP_007054055.1.51653 WP_007054055.1.51719 WP_007054055.1.56191 WP_007054055.1.76144 WP_007054055.1.76173 WP_007054055.1.8287 WP_007054055.1.86174 WP_007054055.1.89707 WP_007054055.1.94251 WP_007054055.1.99722 gi|189438986|ref|YP_001954067.1| 205913.BLD_0123 gi|312132426|ref|YP_003999765.1| gi|384201161|ref|YP_005586908.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]