SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 205913.BLD_0584 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  205913.BLD_0584
Domain Number - Region: 130-174
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.057
Family Laminin G-like module 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 205913.BLD_0584
Sequence length 263
Comment (Bifidobacterium longum DJO10A)
Sequence
MQVALENNIVFVVIEYLAILCWGLSGGLAAIRKGYDIFTIMLCGWLTALGGGLVRDVMLG
ALPPVGITDKGYVLTTLFSGIIVVVAHPEITKLKWTMTVIDALGLGLFAVSGTAKALAYG
SSGMTAVFLGMFTALAGGLIRDIFIGDVPMIIRDKHLYAVPSFIGCILTVLVWRGVSYGW
FDMRSEMLLDVLIVIIVVALRLLSVGFNVTLPGAVERHRVYLPSESRYLKRPVIHPHADT
VDPGDTTKDEEDKPQDGSRPPQG
Download sequence
Identical sequences A0A083X0R2 A0A087AYW5 A0A087BG54 A0A0A1GRL6 B3DSB1 C2GTH6 E5Y161 E8MI36 E8MTE1 I3AZD0 I3BAY0 Q8G601 T2I0Y9
gi|322690961|ref|YP_004220531.1| gi|312132855|ref|YP_004000194.1| NP_696027.1.18194 WP_007053361.1.10685 WP_007053361.1.11999 WP_007053361.1.12982 WP_007053361.1.13888 WP_007053361.1.15467 WP_007053361.1.22978 WP_007053361.1.26381 WP_007053361.1.29295 WP_007053361.1.29792 WP_007053361.1.31269 WP_007053361.1.35161 WP_007053361.1.35419 WP_007053361.1.37587 WP_007053361.1.39030 WP_007053361.1.46548 WP_007053361.1.4820 WP_007053361.1.49187 WP_007053361.1.49359 WP_007053361.1.49397 WP_007053361.1.50584 WP_007053361.1.50944 WP_007053361.1.51274 WP_007053361.1.51653 WP_007053361.1.51719 WP_007053361.1.51739 WP_007053361.1.54925 WP_007053361.1.55246 WP_007053361.1.55537 WP_007053361.1.55576 WP_007053361.1.56191 WP_007053361.1.62466 WP_007053361.1.68920 WP_007053361.1.70526 WP_007053361.1.76144 WP_007053361.1.8287 WP_007053361.1.83561 WP_007053361.1.86174 WP_007053361.1.86404 WP_007053361.1.89707 WP_007053361.1.94003 WP_007053361.1.94251 WP_007053361.1.96408 WP_007053361.1.98069 WP_007053361.1.99105 gi|23465424|ref|NP_696027.1| gi|189439447|ref|YP_001954528.1| 205913.BLD_0584 206672.BL0850 gi|322689079|ref|YP_004208813.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]