SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 205913.BLD_1664 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  205913.BLD_1664
Domain Number 1 Region: 9-152
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.57e-45
Family Ribonuclease PH domain 1-like 0.000000692
Further Details:      
 
Domain Number 2 Region: 327-499
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.06e-42
Family Ribonuclease PH domain 1-like 0.00000116
Further Details:      
 
Domain Number 3 Region: 153-262
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 8.29e-25
Family Ribonuclease PH domain 2-like 0.0000236
Further Details:      
 
Domain Number 4 Region: 481-579
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 5.89e-23
Family Ribonuclease PH domain 2-like 0.0000283
Further Details:      
 
Domain Number 5 Region: 589-676
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.48e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0025
Further Details:      
 
Domain Number 6 Region: 266-352
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 1.41e-16
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.001
Further Details:      
 
Domain Number 7 Region: 652-732
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.58e-16
Family Cold shock DNA-binding domain-like 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 205913.BLD_1664
Sequence length 913
Comment (Bifidobacterium longum DJO10A)
Sequence
MEGPEIKAVEAVIDNGSFGKRTLRFETGRLAQQADGAVAAYLDDDSMILSTTTAGSSPKE
NYDFFPLTVDVEEKMYAAGKIPGSFFRREGRPSSEAILACRIIDRPLRPLFPHTLRNEVQ
VVETVLAVNPDDAYDVIALNAASASTMISGLPFEGPVSGVRLALIDGQWVAFPRWSERER
AVFEIVVAGRVIENGDVAIAMIEAGAGKNAWHLIYDEGQTKPDEEVVAGGLEAAKPFIKV
ICEAQDELKKIAAKETKEFQLFPEYTDELYARIDEIAHKDLDEALSIAEKLPRQDRIHEI
KEHVREVLADEFTDMDDAEKDKELGNAFKELQRQIVRRRILTEDYRIDGRGLRDIRTLSA
EVDIVPRVHGSALFQRGETQILGVTTLNMLKMEQQIDALSGPQSKRYMHNYEMPPYSTGE
TGRVGSPKRREIGHGALAEKALVPVLPSREEFPYAIRQVSEAIGSNGSTSMGSVCASTLS
LLAAGVPLKAPVAGIAMGLVSGDVDGKHIFKTLTDILGAEDAFGDMDFKVAGTSEFITAL
QLDTKLDGIPADILAAALQQAKEARATILEVINECIDGPAEMSEFAPRIITTSVPVEKIG
EVIGPKGKMINQIQEDTGAEIAIEDDGTVFISSEGGEAAEKAKAIIDQIANPHVPEAGET
YNGKVVKTTSFGAFVNLTPGTDGLLHISQIRNLANGERIDAVEDVLKEGDTVEVIVQGVD
DRGKISLAIPGFEDQENNARPSRGDRDDRRGGRGRGDRDDRRGGRGRRSERDDRDFDDRD
DRPRRRRSDDFEDDYDDRPRRRRSDDRDFDRDDRDDDRPRRRRSADRDFDDRDDRDARDS
RDDDRPRRRRSSDRDDRGDRDDRRGGSRGRGRGSDRNPRYATDDNYDDYRADREERTERP
RRRVRRDFDPFED
Download sequence
Identical sequences A0A0A0UD65 A0A0A6VKB3 B3DPX0 D6DC93 Q8G447 T2I334 V6XY66
gi|189440526|ref|YP_001955607.1| NP_696702.1.18194 WP_010081538.1.11999 WP_010081538.1.19800 WP_010081538.1.22978 WP_010081538.1.26381 WP_010081538.1.37185 WP_010081538.1.42164 WP_010081538.1.49359 WP_010081538.1.59461 WP_010081538.1.59950 WP_010081538.1.76144 WP_010081538.1.76388 WP_010081538.1.89707 WP_010081538.1.94713 gi|23466099|ref|NP_696702.1| 205913.BLD_1664 206672.BL1546 gi|479135306|ref|YP_007767106.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]