SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 205914.HS_0703 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  205914.HS_0703
Domain Number 1 Region: 3-143
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 8.1e-50
Family Ribonuclease PH domain 1-like 0.0000134
Further Details:      
 
Domain Number 2 Region: 291-487
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.11e-45
Family Ribonuclease PH domain 1-like 0.0000141
Further Details:      
 
Domain Number 3 Region: 144-234
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.7e-30
Family Ribonuclease PH domain 2-like 0.0008
Further Details:      
 
Domain Number 4 Region: 449-548
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.67e-28
Family Ribonuclease PH domain 2-like 0.0000742
Further Details:      
 
Domain Number 5 Region: 553-638
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.93e-22
Family Eukaryotic type KH-domain (KH-domain type I) 0.0036
Further Details:      
 
Domain Number 6 Region: 619-698
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.04e-20
Family Cold shock DNA-binding domain-like 0.0000812
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 205914.HS_0703
Sequence length 713
Comment (Haemophilus somnus 129PT)
Sequence
MNPIVKQFKYGQHTVTLETGAIARQATAAVMASMDDTSVFVTVVAKKDVKEGQDFFPLTV
NYQERTYAAGRIPGGFFKREGRPSEGETLIARLIDRPIRPLFPEGFFNEIQIIATVVSVN
PQISPDLVAMIGASAALSLSGVPFNGPIGAARVGFINDQFVLNPTMNEQKQSRLDLVVAG
TDKAVLMVESEADILTEEQMLAAVVFGHQQQQIVIEAIKEFAAEAGKPRWDWTAPEANTI
LIEKVKSIAENRLGDAYRITEKQARYEQIDLIKADVITQVTAEDETISEGKIIDIFTALE
SQIVRGRILRGEPRIDGRTVDTVRALDICTGVLPRTHGSAIFTRGETQALAVATLGTERD
AQIIDELTGEKTDHFLFHYNFPPYSVGETGMIGSPKRREIGHGRLAKRGVAAVMPSLSEF
PYVVRVVSEITESNGSSSMASVCGASLALMDAGVPIKAAVAGIAMGLVKEEDNFVVLSDI
LGDEDHLGDMDFKVAGTREGVTALQMDIKIEGITAEIMQIALNQAKSARMHILGVMEQAI
PAPRADISDFAPRIYTMKIDPKKIKDVIGKGGATVRSLTEETGTSIDIDDDGTVKIAAVD
KNAVQEVMSRIEDITAEVEVGVVYKGKVTRLADFGAFVALVGNKEGLVHISQIAEERVEK
VSDYLAIGQEVIVKVLEIDRQGRIRLTMKELAKDQTKNEENLLQSEEGSPVQE
Download sequence
Identical sequences B0UTJ5 Q0I2T0
WP_011608859.1.31663 WP_011608859.1.32721 WP_011608859.1.4486 WP_011608859.1.71281 WP_011608859.1.72297 WP_011608859.1.80424 WP_011608859.1.80932 WP_011608859.1.8746 WP_011608859.1.92579 gi|113460848|ref|YP_718915.1| gi|170717334|ref|YP_001784444.1| 205914.HS_0703 228400.HSM_1114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]