SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 205918.Psyr_0479 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  205918.Psyr_0479
Domain Number 1 Region: 84-213
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.94e-43
Family NlpC/P60 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 205918.Psyr_0479
Sequence length 225
Comment (Pseudomonas syringae pv B728a)
Sequence
MRPFFKTWLTICLFMPLAAHATNREQQLPASFSGYTAKSHSSPALATRNAPQEAATTRTQ
YGATAAVQKPLSRKNAKKVAALQASAPAKQGSAVVKRALQAVGTPYRWGGTTPGKGLDCS
GLVKYAYTDVREVDLPRTSNAMAQGHGQTVDRKDLKPGDLLFFNIKSRNINHVAIYLGDN
KFVHAPRRGKAVTVDTLNKPYWNSHYKIAKRVLPKQAGQMRVVQR
Download sequence
Identical sequences A0A2G0VAF9 A0A2G4EDK9 Q4ZZ73
WP_011266428.1.19682 WP_011266428.1.72581 WP_011266428.1.81892 YP_233587.1.68675 gi|66043746|ref|YP_233587.1| 205918.Psyr_0479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]