SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 205918.Psyr_0758 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  205918.Psyr_0758
Domain Number 1 Region: 26-333
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 8.95e-109
Family Glycosyl hydrolases family 32 N-terminal domain 0.00000142
Further Details:      
 
Domain Number 2 Region: 333-490
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.98e-29
Family Glycosyl hydrolases family 32 C-terminal domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 205918.Psyr_0758
Sequence length 493
Comment (Pseudomonas syringae pv B728a)
Sequence
MSNPMSPALERAHHALEEGLSQLIHDYRPGYHLAPPAGWMNDPNGVVFFRGEYHVFYQHH
PFDAKWGPMYWGHAKSADLVHWQHLPIALAPGDDFDRDGCFSGSAVVCGDTLALIYTGHI
WLGDVGDERFIRQVQCLATSTDGISFVKHGAVIDTPPQDEMIHFRDPKVWRQDGHWYLIA
GARLGDKPLLPLYRSKDLHAWEFVSYVSSGEEGDGYMWECPDLFGLNERDVLLYSPQGMP
AQRYERLNRFHTGYRVGQVDSQWQFTGGPFIELDSGHDFYAAQTLVAADGRRLLWAWIDM
WESPTPTEAHHWRGMLGLPRELEVRENRLCVHPARELTALRDASLPGTAWWSDAGSQWLT
DIHGDMLEIHVQLDLLDCIEGHLGVALRCSPDGQEQTLLYYDASLKRLILDRTQSGTHVS
GQRSVAIDPQQNQLELRIFLDRSSIEVFEQNGSFSFSSRLYPQTDSLGVKLVANGTGGRV
CIANAWQLSSGYL
Download sequence
Identical sequences Q4ZYF6
205918.Psyr_0758 YP_233854.1.68675 gi|66044013|ref|YP_233854.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]