SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 205918.Psyr_1578 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  205918.Psyr_1578
Domain Number - Region: 108-160
Classification Level Classification E-value
Superfamily POZ domain 0.0235
Family BTB/POZ domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 205918.Psyr_1578
Sequence length 238
Comment (Pseudomonas syringae pv B728a)
Sequence
MNETLGIMQPYFFPYIGYFQLIAAVQRGLVFDIVKYKRKSWMNRNRVMGSKGDWQYINVP
VCVSEGALIKDATIIDLACAHRRIKNQLEHYRSQAPYFRETLQVVEQTFGTPATHLCELN
TRALKVVCEYLGMSFNWESCAAMNLDLPPIEHAGQWALEISTVLGARQYINATGGREIFI
PGEWQERGIELRFLEPASFSYSTGPMNFVENLSIIDVLMWNAPETVLAYLHNETRAVI
Download sequence
Identical sequences Q4ZW46
gi|66044823|ref|YP_234664.1| WP_011267107.1.83459 YP_234664.1.68675 205918.Psyr_1578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]